PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004364.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 156aa    MW: 17839.4 Da    PI: 9.9509
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004364.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR134.95e-1120624991
                     FAR1 49 ekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                              ++  ++  tr gC+a+ +  ++++gkw+vtk ++eHnHel+p
  Itr_sc004364.1_g00004.1 20 ANKCYSKIDTRSGCNAMCQFDLDSSGKWVVTKHVKEHNHELCP 62
                             345668899********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-82062IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MPLRRIHLLQ ARFKAKPESA NKCYSKIDTR SGCNAMCQFD LDSSGKWVVT KHVKEHNHEL  60
CPPSASYMLR SHRNVSVDQL TYLKDMKRSG VPLSDGIRFL KHQSGGSPFV GFTARDAYNT  120
MLLDSAKHLD GTDSNTLIEI FRKRQLNESD FFLFRS
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14143211
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-18FAR1-related sequence 5